VAPA (NM_194434) Human Mass Spec Standard
CAT#: PH301164
VAPA MS Standard C13 and N15-labeled recombinant protein (NP_919415)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201164 |
Predicted MW | 27.9 kDa |
Protein Sequence |
>RC201164 protein sequence
Red=Cloning site Green=Tags(s) MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDP GSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLN DMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSD KPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_919415 |
RefSeq Size | 6859 |
RefSeq ORF | 747 |
Synonyms | hVAP-33; VAP-33; VAP-A; VAP33 |
Locus ID | 9218 |
UniProt ID | Q9P0L0 |
Cytogenetics | 18p11.22 |
Summary | The protein encoded by this gene is a type IV membrane protein. It is present in the plasma membrane and intracellular vesicles. It may also be associated with the cytoskeleton. This protein may function in vesicle trafficking, membrane fusion, protein complex assembly and cell motility. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Protein Pathways | Tight junction |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403661 | VAPA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC418581 | VAPA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC429151 | VAPA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY403661 | Transient overexpression lysate of VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa (VAPA), transcript variant 2 |
USD 325.00 |
|
LY418581 | Transient overexpression lysate of VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa (VAPA), transcript variant 1 |
USD 325.00 |
|
LY429151 | Transient overexpression lysate of VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa (VAPA), transcript variant 1 |
USD 325.00 |
|
PH314308 | VAPA MS Standard C13 and N15-labeled recombinant protein (NP_003565) |
USD 2,055.00 |
|
TP301164 | Recombinant protein of human VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa (VAPA), transcript variant 2 |
USD 823.00 |
|
TP314308 | Recombinant protein of human VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa (VAPA), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review