VAPA (NM_194434) Human Recombinant Protein

CAT#: TP301164

Recombinant protein of human VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa (VAPA), transcript variant 2


  View other "VAPA" proteins (9)

USD 823.00

In Stock*

Size
    • 20 ug

Product Images

Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


VAPA mouse monoclonal antibody, clone OTI10E10 (formerly 10E10)
    • 100 ul

USD 379.00

Other products for "VAPA"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC201164 protein sequence
Red=Cloning site Green=Tags(s)

MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDP
GSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLN
DMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSD
KPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 27.7 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_919415
Locus ID 9218
UniProt ID Q9P0L0
Cytogenetics 18p11.22
Refseq Size 6859
Refseq ORF 747
Synonyms hVAP-33; VAMP-A; VAP-33; VAP-A; VAP33
Summary The protein encoded by this gene is a type IV membrane protein. It is present in the plasma membrane and intracellular vesicles. It may also be associated with the cytoskeleton. This protein may function in vesicle trafficking, membrane fusion, protein complex assembly and cell motility. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Jul 2008]
Protein Families Transmembrane
Protein Pathways Tight junction

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.