HIGD2A (NM_138820) Human Mass Spec Standard
CAT#: PH301223
HIGD2A MS Standard C13 and N15-labeled recombinant protein (NP_620175)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201223 |
Predicted MW | 11.5 kDa |
Protein Sequence |
>RC201223 protein sequence
Red=Cloning site Green=Tags(s) MATPGPVIPEVPFEPSKPPVIEGLSPTVYRNPESFKEKFVRKTRENPVVPIGCLATAAALTYGLYSFHRG NSQRSQLMMRTRIAAQGFTVAAILLGLAVTAMKSRP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_620175 |
RefSeq Size | 628 |
RefSeq ORF | 318 |
Synonyms | RCF1b |
Locus ID | 192286 |
UniProt ID | Q9BW72, A0A024R7Q3 |
Cytogenetics | 5q35.2 |
Summary | The protein encoded by this gene is a subunit of the cytochrome c oxidase complex (complex IV), which is the terminal enzyme in the mitochondrial respiratory chain. The encoded protein is an inner mitochondrial membrane protein and is a functional ortholog of the yeast respiratory supercomplex factor 1 (Rcf1). In mouse, the orthologous protein enhances cell survival under conditions of hypoxia. [provided by RefSeq, Sep 2016] |
Protein Families | Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408465 | HIGD2A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY408465 | Transient overexpression lysate of HIG1 hypoxia inducible domain family, member 2A (HIGD2A) |
USD 396.00 |
|
TP301223 | Recombinant protein of human HIG1 hypoxia inducible domain family, member 2A (HIGD2A) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review