HIGD2A (NM_138820) Human Recombinant Protein
CAT#: TP301223
Recombinant protein of human HIG1 hypoxia inducible domain family, member 2A (HIGD2A)
View other "HIGD2A" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201223 protein sequence
Red=Cloning site Green=Tags(s) MATPGPVIPEVPFEPSKPPVIEGLSPTVYRNPESFKEKFVRKTRENPVVPIGCLATAAALTYGLYSFHRG NSQRSQLMMRTRIAAQGFTVAAILLGLAVTAMKSRP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_620175 |
Locus ID | 192286 |
UniProt ID | Q9BW72, A0A024R7Q3 |
Cytogenetics | 5q35.2 |
Refseq Size | 628 |
Refseq ORF | 318 |
Synonyms | RCF1b |
Summary | The protein encoded by this gene is a subunit of the cytochrome c oxidase complex (complex IV), which is the terminal enzyme in the mitochondrial respiratory chain. The encoded protein is an inner mitochondrial membrane protein and is a functional ortholog of the yeast respiratory supercomplex factor 1 (Rcf1). In mouse, the orthologous protein enhances cell survival under conditions of hypoxia. [provided by RefSeq, Sep 2016] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408465 | HIGD2A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY408465 | Transient overexpression lysate of HIG1 hypoxia inducible domain family, member 2A (HIGD2A) |
USD 396.00 |
|
PH301223 | HIGD2A MS Standard C13 and N15-labeled recombinant protein (NP_620175) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review