NCF1 (NM_000265) Human Mass Spec Standard

CAT#: PH301233

NCF1 MS Standard C13 and N15-labeled recombinant protein (NP_000256)

Product Images

Coomassie blue staining of purified NCF1 protein (Cat# TP301233). The protein was produced from HEK293T cells transfected with NCF1 cDNA clone (Cat# RC201233) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201233
• Predicted MW: 44.5 kDa
• Protein Sequence:
  Sequence Link

  >RC201233 representing NM_000265
  Red=Cloning site Green=Tags(s)
  
  MGDTFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENR
  IIPHLPAPKWFDGQRAAENRQGTLTEYCSTLMSLPTKISRCPHLLDFFKVRPDDLKLPTDNQTKKPETYL
  MPKDGKSTATDITGPIILQTYRAIANYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKAKRGWIPASFL
  EPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYL
  QKSGQDVSQAQRQIKRGAPPRRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRRRQARPGPQSPGSPL
  EEERQTQRSKPQPAVPPRPSADLILNRCSESTKRKLASPV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000256
• RefSeq Size: 1409
• RefSeq ORF: 1170
• Synonyms: CGD1; NCF1A; NOXO2; p47phox; SH3PXD1A
• Locus ID: 653361
• UniProt ID: P14598
• Cytogenetics: 7q11.23
• Summary: The protein encoded by this gene is a 47 kDa cytosolic subunit of neutrophil NADPH oxidase. This oxidase is a multicomponent enzyme that is activated to produce superoxide anion. Mutations in this gene have been associated with chronic granulomatous disease. [provided by RefSeq, Jul 2008]
• Protein Pathways: Chemokine signaling pathway, Fc gamma R-mediated phagocytosis, Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton