UAP56 (DDX39B) (NM_004640) Human Mass Spec Standard
CAT#: PH301248
BAT1 MS Standard C13 and N15-labeled recombinant protein (NP_004631)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201248 |
Predicted MW | 49 kDa |
Protein Sequence |
>RC201248 protein sequence
Red=Cloning site Green=Tags(s) MAENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSE VQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYM PNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRD VQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFD LLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRG MDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDI SSYIEQTR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_004631 |
RefSeq Size | 2174 |
RefSeq ORF | 1284 |
Synonyms | BAT1; D6S81E; UAP56 |
Locus ID | 7919 |
UniProt ID | Q13838, A0A024RCM3 |
Cytogenetics | 6p21.33 |
Summary | This gene encodes a member of the DEAD box family of RNA-dependent ATPases that mediate ATP hydrolysis during pre-mRNA splicing. The encoded protein is an essential splicing factor required for association of U2 small nuclear ribonucleoprotein with pre-mRNA, and it also plays an important role in mRNA export from the nucleus to the cytoplasm. This gene belongs to a cluster of genes localized in the vicinity of the genes encoding tumor necrosis factor alpha and tumor necrosis factor beta. These genes are all within the human major histocompatibility complex class III region. Mutations in this gene may be associated with rheumatoid arthritis. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on both chromosomes 6 and 11. Read-through transcription also occurs between this gene and the upstream ATP6V1G2 (ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G2) gene. [provided by RefSeq, Feb 2011] |
Protein Pathways | Spliceosome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401471 | DDX39B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC409144 | DDX39B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY401471 | Transient overexpression lysate of HLA-B associated transcript 1 (BAT1), transcript variant 1 |
USD 325.00 |
|
LY409144 | Transient overexpression lysate of HLA-B associated transcript 1 (BAT1), transcript variant 2 |
USD 325.00 |
|
PH301847 | BAT1 MS Standard C13 and N15-labeled recombinant protein (NP_542165) |
USD 2,055.00 |
|
TP301248 | Recombinant protein of human HLA-B associated transcript 1 (BAT1), transcript variant 1 |
USD 823.00 |
|
TP301847 | Recombinant protein of human HLA-B associated transcript 1 (BAT1), transcript variant 2 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review