p23 (PTGES3) (NM_006601) Human Mass Spec Standard

CAT#: PH301254

PTGES3 MS Standard C13 and N15-labeled recombinant protein (NP_006592)

Product Images

Coomassie blue staining of purified PTGES3 protein (Cat# TP301254). The protein was produced from HEK293T cells transfected with PTGES3 cDNA clone (Cat# RC201254) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201254
• Predicted MW: 18.7 kDa
• Protein Sequence:
  Sequence Link

  >RC201254 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTD
  RSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPE
  VDGADDDSQDSDDEKMPDLE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006592
• RefSeq Size: 2045
• RefSeq ORF: 480
• Synonyms: cPGES; P23; TEBP
• Locus ID: 10728
• UniProt ID: Q15185, A0A024RB32
• Cytogenetics: 12
• Summary: This gene encodes an enzyme that converts prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). This protein functions as a co-chaperone with heat shock protein 90 (HSP90), localizing to response elements in DNA and disrupting transcriptional activation complexes. Alternative splicing results in multiple transcript variants. There are multiple pseudogenes of this gene on several different chromosomes. [provided by RefSeq, Feb 2016]
• Protein Families: Druggable Genome, Nuclear Hormone Receptor