PSME1 (NM_006263) Human Mass Spec Standard
CAT#: PH301260
PSME1 MS Standard C13 and N15-labeled recombinant protein (NP_006254)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201260 |
Predicted MW | 28.7 kDa |
Protein Sequence |
>RC201260 protein sequence
Red=Cloning site Green=Tags(s) MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVK EKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIP RIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYR DIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_006254 |
RefSeq Size | 1023 |
RefSeq ORF | 747 |
Synonyms | HEL-S-129m; IFI5111; PA28A; PA28alpha; REGalpha |
Locus ID | 5720 |
UniProt ID | Q06323, A0A0K0K1L8 |
Cytogenetics | 14q12 |
Summary | 'The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the alpha subunit of the 11S regulator, one of the two 11S subunits that is induced by gamma-interferon. Three alpha and three beta subunits combine to form a heterohexameric ring. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]' |
Protein Pathways | Antigen processing and presentation, Proteasome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401886 | PSME1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401886 | Transient overexpression lysate of proteasome (prosome, macropain) activator subunit 1 (PA28 alpha) (PSME1), transcript variant 1 |
USD 396.00 |
|
TP301260 | Recombinant protein of human proteasome (prosome, macropain) activator subunit 1 (PA28 alpha) (PSME1), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review