YL1 (VPS72) (NM_005997) Human Mass Spec Standard
CAT#: PH301273
VPS72 MS Standard C13 and N15-labeled recombinant protein (NP_005988)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201273 |
Predicted MW | 40.6 kDa |
Protein Sequence |
>RC201273 protein sequence
Red=Cloning site Green=Tags(s) MSLAGGRAPRKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDTEDEVDSDFDIDEGDEPS SDGEAEEPRRKRRVVTKAYKEPLKSLRPRKVNTPAGSSQKAREEKALLPLELQDDGSDSRKSMRQSTAEH TRQTFLRVQERQGQSRRRKGPHCERPLTQEELLREAKITEELNLRSLETYERLEADKKKQVHKKRKCPGP IITYHSVTVPLVGEPGPKEENVDIEGLDPAPSVSALTPHAGTGPVNPPARCSRTFITFSDDATFEEWFPQ GRPPKVPVREVCPVTHRPALYRDPVTDIPYATARAFKIIREAYKKYITAHGLPPTASALGPGPPPPEPLP GSGPRALRQKIVIK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005988 |
RefSeq Size | 1546 |
RefSeq ORF | 1092 |
Synonyms | CFL1; Swc2; TCFL1; YL-1; YL1 |
Locus ID | 6944 |
UniProt ID | Q15906 |
Cytogenetics | 1q21.3 |
Summary | 'The protein encoded by this gene is a shared subunit of two multi-component complexes, the histone acetyltransferase complex TRRAP/TIP60 as well as the chromatin remodeling SRCAP-containing complex. The TRRAP/TIP60 complex acetylates nucleosomal histones important for transcriptional regulation, double strand DNA break repair and apoptosis. The SRCAP-containing complex catalyzes the exchange of histone H2A with the histone variant Htz1 (H2AFZ) into nucleosomes. This protein may be responsible for binding H2AFZ, which has a role in chromosome segregation. This protein may also have a role in regulating long-term hematopoietic stem cell activity. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Aug 2012]' |
Protein Families | Transcription Factors |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416942 | VPS72 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY416942 | Transient overexpression lysate of vacuolar protein sorting 72 homolog (S. cerevisiae) (VPS72) |
USD 396.00 |
|
TP301273 | Recombinant protein of human vacuolar protein sorting 72 homolog (S. cerevisiae) (VPS72) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review