SIX2 (NM_016932) Human Mass Spec Standard

CAT#: PH301328

SIX2 MS Standard C13 and N15-labeled recombinant protein (NP_058628)

Product Images

Coomassie blue staining of purified SIX2 protein (Cat# TP301328). The protein was produced from HEK293T cells transfected with SIX2 cDNA clone (Cat# RC201328) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201328
• Predicted MW: 32.3 kDa
• Protein Sequence:
  Sequence Link

  >RC201328 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSMLPTFGFTQEQVACVCEVLQQGGNIERLGRFLWSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKIL
  ESHQFSPHNHAKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKEKSRSVLR
  EWYAHNPYPSPREKRELTEATGLTTTQVSNWFKNRRQRDRAAEAKERENNENSNSNSHNPLNGSGKSVLG
  SSEDEKTPSGTPDHSSSSPALLLSPPPPGLPSLHSLGHPPGPSAVPVPVPGGGGADPLQHHHGLQDSILN
  PMSANLVDLGS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_058628
• RefSeq Size: 2178
• RefSeq ORF: 873
• Locus ID: 10736
• UniProt ID: Q9NPC8, Q8TBA2
• Cytogenetics: 2p21
• Summary: This gene is a member of the vertebrate gene family which encode proteins homologous to the Drosophila 'sine oculis' homeobox protein. The encoded protein is a transcription factor which, like other members of this gene family, may be involved in limb or eye development. [provided by RefSeq, Dec 2008]
• Protein Families: Transcription Factors