PP2A-alpha (PPP2CA) (NM_002715) Human Mass Spec Standard

CAT#: PH301334

PPP2CA MS Standard C13 and N15-labeled recombinant protein (NP_002706)

Product Images

Coomassie blue staining of purified PPP2CA protein (Cat# TP301334). The protein was produced from HEK293T cells transfected with PPP2CA cDNA clone (Cat# RC201334) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201334
• Predicted MW: 35.6 kDa
• Protein Sequence:
  Sequence Link

  >RC201334 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFR
  IGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNA
  NVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWG
  ISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDD
  TLKYSFLQFDPAPRRGEPHVTRRTPDYFL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002706
• RefSeq Size: 2643
• RefSeq ORF: 927
• Synonyms: NEDLBA; PP2Ac; PP2CA; PP2Calpha; RP-C
• Locus ID: 5515
• UniProt ID: P67775, B3KUN1
• Cytogenetics: 5q31.1
• Summary: 'This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes an alpha isoform of the catalytic subunit. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Phosphatase, Transcription Factors
• Protein Pathways: Long-term depression, Oocyte meiosis, TGF-beta signaling pathway, Tight junction, Wnt signaling pathway