SIGIRR (NM_021805) Human Mass Spec Standard

CAT#: PH301356

SIGIRR MS Standard C13 and N15-labeled recombinant protein (NP_068577)

Product Images

Coomassie blue staining of purified SIGIRR protein (Cat# TP301356). The protein was produced from HEK293T cells transfected with SIGIRR cDNA clone (Cat# RC201356) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201356
• Predicted MW: 45.7 kDa
• Protein Sequence:
  Sequence Link

  >RC201356 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPGVCDRAPDFLSPSEDQVLRPALGSSVALNCTAWVVSGPHCSLPSVQWLKDGLPLGIGGHYSLHEYSWV
  KANLSEVLVSSVLGVNVTSTEVYGAFTCSIQNISFSSFTLQRAGPTSHVAAVLASLLVLLALLLAALLYV
  KCRLNVLLWYQDAYGEVEINDGKLYDAYVSYSDCPEDRKFVNFILKPQLERRRGYKLFLDDRDLLPRAEP
  SADLLVNLSRCRRLIVVLSDAFLSRAWCSHSFREGLCRLLELTRRPIFITFEGQRRDPAHPALRLLRQHR
  HLVTLLLWRPGSVTPSSDFWKEVQLALPRKVRYRPVEGDPQTQLQDDKDPMLILRGRVPEGRALDSEVDP
  DPEGDLGVRGPVFGEPSAPPHTSGVSLGESRSSEVDVSDLGSRNYSARTDFYCLVSKDDM
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_068577
• RefSeq Size: 1657
• RefSeq ORF: 1230
• Synonyms: IL-1R8; TIR8
• Locus ID: 59307
• UniProt ID: Q6IA17
• Cytogenetics: 11p15.5
• Protein Families: Transcription Factors, Transmembrane