MYL12B (NM_033546) Human Mass Spec Standard

CAT#: PH301372

MYL12B MS Standard C13 and N15-labeled recombinant protein (NP_291024)

Product Images

Coomassie blue staining of purified MYL12B protein (Cat# TP301372). The protein was produced from HEK293T cells transfected with MYL12B cDNA clone (Cat# RC201372) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201372
• Predicted MW: 19.8 kDa
• Protein Sequence:
  Sequence Link

  >RC201372 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYL
  DAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVD
  ELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_291024
• RefSeq Size: 1022
• RefSeq ORF: 516
• Synonyms: MLC-B; MRLC2
• Locus ID: 103910
• UniProt ID: O14950
• Cytogenetics: 18p11.31
• Summary: The activity of nonmuscle myosin II (see MYH9; MIM 160775) is regulated by phosphorylation of a regulatory light chain, such as MRLC2. This phosphorylation results in higher MgATPase activity and the assembly of myosin II filaments (Iwasaki et al., 2001 [PubMed 11942626]). [supplied by OMIM, Mar 2008]
• Protein Pathways: Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction