EIF4EL3 (EIF4E2) (NM_004846) Human Mass Spec Standard

CAT#: PH301391

EIF4E2 MS Standard C13 and N15-labeled recombinant protein (NP_004837)

Product Images

Coomassie blue staining of purified EIF4E2 protein (Cat# TP301391). The protein was produced from HEK293T cells transfected with EIF4E2 cDNA clone (Cat# RC201391) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201391
• Predicted MW: 28.4 kDa
• Protein Sequence:
  Sequence Link

  >RC201391 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPG
  RPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLR
  KGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNT
  IMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004837
• RefSeq Size: 1078
• RefSeq ORF: 735
• Synonyms: 4E-LP; 4EHP; EIF4EL3; h4EHP; IF4e
• Locus ID: 9470
• UniProt ID: O60573, Q53RG0
• Cytogenetics: 2q37.1
• Summary: Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation (PubMed:9582349, PubMed:17368478, PubMed:25624349). Acts as a repressor of translation initiation (PubMed:22751931). In contrast to EIF4E, it is unable to bind eIF4G (EIF4G1, EIF4G2 or EIF4G3), suggesting that it acts by competing with EIF4E and block assembly of eIF4F at the cap. [UniProtKB/Swiss-Prot Function]
• Protein Families: Transcription Factors
• Protein Pathways: Insulin signaling pathway, mTOR signaling pathway