PA1 (PAGR1) (NM_024516) Human Mass Spec Standard

CAT#: PH301417

C16orf53 MS Standard C13 and N15-labeled recombinant protein (NP_078792)

Product Images

Coomassie blue staining of purified PAGR1 protein (Cat# TP301417). The protein was produced from HEK293T cells transfected with PAGR1 cDNA clone (Cat# RC201417) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201417
• Predicted MW: 27.7 kDa
• Protein Sequence:
  Sequence Link

  >RC201417 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSLARGHGDTAASTAAPLSEEGEVTSGLQALAVEDTGGPSASAGKAEDEGEGGREETEREGSGGEEAQGE
  VPSAGGEEPAEEDSEDWCVPCSDEEVELPADGQPWMPPPSEIQRLYELLAAHGTLELQAEILPRRPPTPE
  AQSEEERSDEEPEAKEEEEEKPHMPTEFDFDDEPVTPKDSLIDRRRTPGSSARSQKREARLDKVLSDMKR
  HKKLEEQILRTGRDLFSLDSEDPSPASPPLRSSGSSLFPRQRKY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_078792
• RefSeq Size: 3843
• RefSeq ORF: 762
• Synonyms: C16orf53; GAS; PA1
• Locus ID: 79447
• UniProt ID: Q9BTK6
• Cytogenetics: 16p11.2
• Summary: C16ORF53 (PA1) is a component of a Set1-like multiprotein histone methyltransferase complex (Cho et al., 2007 [PubMed 17500065]). [supplied by OMIM, May 2008]