PA1 (PAGR1) (NM_024516) Human Recombinant Protein

CAT#: TP301417

Recombinant protein of human chromosome 16 open reading frame 53 (C16orf53)

Product Images

Coomassie blue staining of purified PAGR1 protein (Cat# TP301417). The protein was produced from HEK293T cells transfected with PAGR1 cDNA clone (Cat# RC201417) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201417 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSLARGHGDTAASTAAPLSEEGEVTSGLQALAVEDTGGPSASAGKAEDEGEGGREETEREGSGGEEAQGE
  VPSAGGEEPAEEDSEDWCVPCSDEEVELPADGQPWMPPPSEIQRLYELLAAHGTLELQAEILPRRPPTPE
  AQSEEERSDEEPEAKEEEEEKPHMPTEFDFDDEPVTPKDSLIDRRRTPGSSARSQKREARLDKVLSDMKR
  HKKLEEQILRTGRDLFSLDSEDPSPASPPLRSSGSSLFPRQRKY
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 27.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_078792
• Locus ID: 79447
• UniProt ID: Q9BTK6
• Cytogenetics: 16p11.2
• Refseq Size: 3843
• Refseq ORF: 762
• Synonyms: C16orf53; GAS; PA1
• Summary: C16ORF53 (PA1) is a component of a Set1-like multiprotein histone methyltransferase complex (Cho et al., 2007 [PubMed 17500065]).[supplied by OMIM, May 2008]