SAR1 (SAR1A) (NM_020150) Human Mass Spec Standard

CAT#: PH301450

SAR1A MS Standard C13 and N15-labeled recombinant protein (NP_064535)

Product Images

Coomassie blue staining of purified SAR1A protein (Cat# TP301450). The protein was produced from HEK293T cells transfected with SAR1A cDNA clone (Cat# RC201450) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201450
• Predicted MW: 22.4 kDa
• Protein Sequence:
  Sequence Link

  >RC201450 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSFIFEWIYNGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSEELTIAGMT
  FTTFDLGGHEQARRVWKNYLPAINGIVFLVDCADHSRLVESKVELNALMTDETISNVPILILGNKIDRTD
  AISEEKLREIFGLYGQTTGKGNVTLKELNARPMEVFMCSVLKRQGYGEGFRWLSQYID
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_064535
• RefSeq Size: 3018
• RefSeq ORF: 594
• Synonyms: masra2; SAR1; Sara; SARA1
• Locus ID: 56681
• UniProt ID: Q9NR31, Q5SQT9
• Cytogenetics: 10q22.1