YPEL5 (NM_016061) Human Mass Spec Standard

CAT#: PH301463

YPEL5 MS Standard C13 and N15-labeled recombinant protein (NP_057145)

Product Images

Coomassie blue staining of purified YPEL5 protein (Cat# TP301463). The protein was produced from HEK293T cells transfected with YPEL5 cDNA clone (Cat# RC201463) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201463
• Predicted MW: 13.8 kDa
• Protein Sequence:
  Sequence Link

  >RC201463 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGRIFLDHIGGTRLFSCANCDTILTNRSELISTRFTGATGRAFLFNKVVNLQYSEVQDRVMLTGRHMVRD
  VSCKNCNSKLGWIYEFATEDSQRYKEGRVILERALVRESEGFEEHVPSDNS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057145
• RefSeq Size: 2281
• RefSeq ORF: 363
• Synonyms: CGI-127
• Locus ID: 51646
• UniProt ID: P62699
• Cytogenetics: 2p23.1