RAB10 (NM_016131) Human Mass Spec Standard

CAT#: PH301464

RAB10 MS Standard C13 and N15-labeled recombinant protein (NP_057215)

Product Images

Coomassie blue staining of purified RAB10 protein (Cat# TP301464). The protein was produced from HEK293T cells transfected with RAB10 cDNA clone (Cat# RC201464) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201464
• Predicted MW: 22.5 kDa
• Protein Sequence:
  Sequence Link

  >RC201464 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQER
  FHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQI
  AREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057215
• RefSeq Size: 3785
• RefSeq ORF: 600
• Synonyms: Ac1075; RAB10, member RAS oncogene family; ras-related protein rab10
• Locus ID: 10890
• UniProt ID: P61026
• Cytogenetics: 2p23.3
• Summary: RAB10 belongs to the RAS (see HRAS; MIM 190020) superfamily of small GTPases. RAB proteins localize to exocytic and endocytic compartments and regulate intracellular vesicle trafficking (Bao et al., 1998 [PubMed 9918381]). [supplied by OMIM, Mar 2009]
• Protein Families: Druggable Genome