ERLEC1 (NM_015701) Human Mass Spec Standard
CAT#: PH301486
ERLEC1 MS Standard C13 and N15-labeled recombinant protein (NP_056516)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201486 |
Predicted MW | 54.9 kDa |
Protein Sequence |
>RC201486 protein sequence
Red=Cloning site Green=Tags(s) MEEGGGGVRSLVPGGPVLLVLCGLLEASGGGRALPQLSDDIPFRVNWPGTEFSLPTTGVLYKEDNYVIMT TAHKEKYKCILPLVTSGDEEEEKDYKGPNPRELLEPLFKQSSCSYRIESYWTYEVCHGKHIRQYHEEKET GQKINIHEYYLGNMLAKNLLFEKEREAEEKEKSNEIPTKNIEGQMTPYYPVGMGNGTPCSLKQNRPRSST VMYICHPESKHEILSVAEVTTCEYEVVILTPLLCSHPKYRFRASPVNDIFCQSLPGSPFKPLTLRQLEQQ EEILRVPFRRNKEEDLQSTKEERFPAIHKSIAIGSQPVLTVGTTHISKLTDDQLIKEFLSGSYCFRGGVG WWKYEFCYGKHVHQYHEDKDSGKTSVVVGTWNQEEHIEWAKKNTARAYHLQDDGTQTVRMVSHFYGNGDI CDITDKPRQVTVKLKCKESDSPHAVTVYMLEPHSCQYILGVESPVICKILDTADENGLLSLPN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_056516 |
RefSeq Size | 2605 |
RefSeq ORF | 1449 |
Synonyms | C2orf30; CIM; CL24936; CL25084; HEL117; XTP3-B; XTP3TPB |
Locus ID | 27248 |
UniProt ID | Q96DZ1, V9HWD3 |
Cytogenetics | 2p16.2 |
Summary | This gene encodes a resident endoplasmic reticulum (ER) protein that functions in N-glycan recognition. This protein is thought to be involved in ER-associated degradation via its interaction with the membrane-associated ubiquitin ligase complex. It also functions as a regulator of multiple cellular stress-response pathways in a manner that promotes metastatic cell survival. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 21. [provided by RefSeq, Aug 2011] |
Protein Families | Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414394 | ERLEC1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426779 | ERLEC1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY414394 | Transient overexpression lysate of endoplasmic reticulum lectin 1 (ERLEC1), transcript variant 1 |
USD 396.00 |
|
LY426779 | Transient overexpression lysate of endoplasmic reticulum lectin 1 (ERLEC1), transcript variant 2 |
USD 396.00 |
|
TP301486 | Recombinant protein of human chromosome 2 open reading frame 30 (C2orf30), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review