NCBP2 (NM_007362) Human Mass Spec Standard

CAT#: PH301519

NCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_031388)

Product Images

Coomassie blue staining of purified NCBP2 protein (Cat# TP301519). The protein was produced from HEK293T cells transfected with NCBP2 cDNA clone (Cat# RC201519) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201519
• Predicted MW: 18 kDa
• Protein Sequence:
  Sequence Link

  >RC201519 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKII
  MGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYRQ
  DYDAGRGGYGKLAQNQ
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_031388
• RefSeq Size: 2175
• RefSeq ORF: 468
• Synonyms: CBC2; CBP20; NIP1; PIG55
• Locus ID: 22916
• UniProt ID: P52298
• Cytogenetics: 3q29
• Summary: The product of this gene is a component of the nuclear cap-binding protein complex (CBC), which binds to the monomethylated 5' cap of nascent pre-mRNA in the nucleoplasm. The encoded protein has an RNP domain commonly found in RNA binding proteins, and contains the cap-binding activity. The CBC promotes pre-mRNA splicing, 3'-end processing, RNA nuclear export, and nonsense-mediated mRNA decay. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Spliceosome