PPIH (NM_006347) Human Mass Spec Standard
CAT#: PH301529
PPIH MS Standard C13 and N15-labeled recombinant protein (NP_006338)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201529 |
Predicted MW | 19.2 kDa |
Protein Sequence |
>RC201529 protein sequence
Red=Cloning site Green=Tags(s) MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIK DFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVV FGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_006338 |
RefSeq Size | 813 |
RefSeq ORF | 531 |
Synonyms | CYP-20; CYPH; SnuCyp-20; USA-CYP |
Locus ID | 10465 |
UniProt ID | O43447, Q6FH36 |
Cytogenetics | 1p34.2 |
Summary | The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a specific component of the complex that includes pre-mRNA processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri-snRNP. This protein has been shown to possess PPIase activity and may act as a protein chaperone that mediates the interactions between different proteins inside the spliceosome. [provided by RefSeq, Jul 2008] |
Protein Pathways | Spliceosome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416702 | PPIH HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY416702 | Transient overexpression lysate of peptidylprolyl isomerase H (cyclophilin H) (PPIH) |
USD 396.00 |
|
TP301529 | Recombinant protein of human peptidylprolyl isomerase H (cyclophilin H) (PPIH) |
USD 823.00 |
|
TP720226 | Recombinant protein of human peptidylprolyl isomerase H (cyclophilin H) (PPIH) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review