S100P (NM_005980) Human Mass Spec Standard

CAT#: PH301533

S100P MS Standard C13 and N15-labeled recombinant protein (NP_005971)

Product Images

Coomassie blue staining of purified S100P protein (Cat# TP301533). The protein was produced from HEK293T cells transfected with S100P cDNA clone (Cat# RC201533) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201533
• Predicted MW: 10.4 kDa
• Protein Sequence:
  Sequence Link

  >RC201533 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVD
  FSEFIVFVAAITSACHKYFEKAGLK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005971
• RefSeq Size: 510
• RefSeq ORF: 285
• Synonyms: MIG9
• Locus ID: 6286
• UniProt ID: P25815
• Cytogenetics: 4p16.1
• Summary: 'The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 4p16. This protein, in addition to binding Ca2+, also binds Zn2+ and Mg2+. This protein may play a role in the etiology of prostate cancer. [provided by RefSeq, Jul 2008]'