S100P (NM_005980) Human Recombinant Protein

CAT#: TP301533

Recombinant protein of human S100 calcium binding protein P (S100P)

Product Images

Coomassie blue staining of purified S100P protein (Cat# TP301533). The protein was produced from HEK293T cells transfected with S100P cDNA clone (Cat# RC201533) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201533 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVD
  FSEFIVFVAAITSACHKYFEKAGLK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 10.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005971
• Locus ID: 6286
• UniProt ID: P25815
• Cytogenetics: 4p16.1
• Refseq Size: 510
• Refseq ORF: 285
• Synonyms: MIG9
• Summary: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 4p16. This protein, in addition to binding Ca2+, also binds Zn2+ and Mg2+. This protein may play a role in the etiology of prostate cancer. [provided by RefSeq, Jul 2008]