Annexin A3 (ANXA3) (NM_005139) Human Mass Spec Standard

CAT#: PH301540

ANXA3 MS Standard C13 and N15-labeled recombinant protein (NP_005130)

Product Images

Coomassie blue staining of purified ANXA3 protein (Cat# TP301540). The protein was produced from HEK293T cells transfected with ANXA3 cDNA clone (Cat# RC201540) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201540
• Predicted MW: 36.4 kDa
• Protein Sequence:
  Sequence Link

  >RC201540 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSNAQRQLIVKEYQAAYGKELKD
  DLKGDLSGHFEHLMVALVTPPAVFDAKQLKKSMKGAGTNEDALIEILTTRTSRQMKDISQAYYTVYKKSL
  GDDISSETSGDFRKALLTLADGRRDESLKVDEHLAKQDAQILYKAGENRWGTDEDKFTEILCLRSFPQLK
  LTFDEYRNISQKDIVDSIKGELSGHFEDLLLAIVNCVRNTPAFLAERLHRALKGIGTDEFTLNRIMVSRS
  EIDLLDIRTEFKKHYGYSLYSAIKSDTSGDYEITLLKICGGDD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005130
• RefSeq Size: 1634
• RefSeq ORF: 969
• Synonyms: ANX3
• Locus ID: 306
• UniProt ID: P12429
• Cytogenetics: 4q21.21
• Summary: 'This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions in the inhibition of phopholipase A2 and cleavage of inositol 1,2-cyclic phosphate to form inositol 1-phosphate. This protein may also play a role in anti-coagulation. [provided by RefSeq, Jul 2008]'
• Protein Families: Stem cell - Pluripotency