N myc interactor (NMI) (NM_004688) Human Mass Spec Standard

CAT#: PH301543

NMI MS Standard C13 and N15-labeled recombinant protein (NP_004679)

Product Images

Coomassie blue staining of purified NMI protein (Cat# TP301543). The protein was produced from HEK293T cells transfected with NMI cDNA clone (Cat# RC201543) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201543
• Predicted MW: 35.1 kDa
• Protein Sequence:
  Sequence Link

  >RC201543 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLKKEIQKLETELQEATKEFQIKEDIPETKMK
  FLSVETPENDSQLSNISCSFQVSSKVPYEIQKGQALITFEKEEVAQNVVSMSKHHVQIKDVNLEVTAKPV
  PLNSGVRFQVYVEVSKMKINVTEIPDTLREDQMRDKLELSFSKSRNGGGEVDRVDYDRQSGSAVITFVEI
  GVADKILKKKEYPLYINQTCHRVTVSPYTEIHLKKYQIFSGTSKRTVLLTGMEGIQMDEEIVEDLINIHF
  QRAKNGGGEVDVVKCSLGQPHIAYFEE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004679
• RefSeq Size: 1501
• RefSeq ORF: 921
• Synonyms: N-myc (and STAT) interactor; N-myc-interactor; N-myc and STAT interactor; N-myc interactor
• Locus ID: 9111
• UniProt ID: Q13287
• Cytogenetics: 2q23.3
• Summary: NMYC interactor (NMI) encodes a protein that interacts with NMYC and CMYC (two members of the oncogene Myc family), and other transcription factors containing a Zip, HLH, or HLH-Zip motif. The NMI protein also interacts with all STATs except STAT2 and augments STAT-mediated transcription in response to cytokines IL2 and IFN-gamma. The NMI mRNA has low expression levels in all human fetal and adult tissues tested except brain and has high expression in cancer cell line-myeloid leukemias. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transcription Factors