ELAVL1 (NM_001419) Human Mass Spec Standard

CAT#: PH301562

ELAVL1 MS Standard C13 and N15-labeled recombinant protein (NP_001410)

Product Images

Coomassie blue staining of purified ELAVL1 protein (Cat# TP301562). The protein was produced from HEK293T cells transfected with ELAVL1 cDNA clone (Cat# RC201562) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201562
• Predicted MW: 36.1 kDa
• Protein Sequence:
  Sequence Link

  >RC201562 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSNGYEDHMAEDCRGDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVT
  AKDAERAINTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQKDVEDMFSRFGRIINSRVLVD
  QTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAANPNQNKNVALLSQLYHSPARRFGGP
  VHHQAQRFRFSPMGVDHMSGLSGVNVPGNASSGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFN
  TNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVSFKTNKSHK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001410
• RefSeq Size: 6075
• RefSeq ORF: 978
• Synonyms: ELAV1; Hua; HUR; MelG
• Locus ID: 1994
• UniProt ID: Q15717
• Cytogenetics: 19p13.2
• Summary: 'The protein encoded by this gene is a member of the ELAVL family of RNA-binding proteins that contain several RNA recognition motifs, and selectively bind AU-rich elements (AREs) found in the 3' untranslated regions of mRNAs. AREs signal degradation of mRNAs as a means to regulate gene expression, thus by binding AREs, the ELAVL family of proteins play a role in stabilizing ARE-containing mRNAs. This gene has been implicated in a variety of biological processes and has been linked to a number of diseases, including cancer. It is highly expressed in many cancers, and could be potentially useful in cancer diagnosis, prognosis, and therapy. [provided by RefSeq, Sep 2012]'