CSRP2 (NM_001321) Human Mass Spec Standard
CAT#: PH301565
CSRP2 MS Standard C13 and N15-labeled recombinant protein (NP_001312)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201565 |
Predicted MW | 21 kDa |
Protein Sequence |
>RC201565 protein sequence
Red=Cloning site Green=Tags(s) MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKG YGYGQGAGTLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWH KNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001312 |
RefSeq Size | 940 |
RefSeq ORF | 579 |
Synonyms | CRP2; LMO5; SmLIM |
Locus ID | 1466 |
UniProt ID | Q16527, A0A024RBB5 |
Cytogenetics | 12q21.2 |
Summary | 'CSRP2 is a member of the CSRP family of genes, encoding a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. CRP2 contains two copies of the cysteine-rich amino acid sequence motif (LIM) with putative zinc-binding activity, and may be involved in regulating ordered cell growth. Other genes in the family include CSRP1 and CSRP3. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]' |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400526 | CSRP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400526 | Transient overexpression lysate of cysteine and glycine-rich protein 2 (CSRP2) |
USD 325.00 |
|
TP301565 | Recombinant protein of human cysteine and glycine-rich protein 2 (CSRP2) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review