CSRP2 (NM_001321) Human Mass Spec Standard

CAT#: PH301565

CSRP2 MS Standard C13 and N15-labeled recombinant protein (NP_001312)

Product Images

Coomassie blue staining of purified CSRP2 protein (Cat# TP301565). The protein was produced from HEK293T cells transfected with CSRP2 cDNA clone (Cat# RC201565) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201565
• Predicted MW: 21 kDa
• Protein Sequence:
  Sequence Link

  >RC201565 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKG
  YGYGQGAGTLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWH
  KNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001312
• RefSeq Size: 940
• RefSeq ORF: 579
• Synonyms: CRP2; LMO5; SmLIM
• Locus ID: 1466
• UniProt ID: Q16527, A0A024RBB5
• Cytogenetics: 12q21.2
• Summary: 'CSRP2 is a member of the CSRP family of genes, encoding a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. CRP2 contains two copies of the cysteine-rich amino acid sequence motif (LIM) with putative zinc-binding activity, and may be involved in regulating ordered cell growth. Other genes in the family include CSRP1 and CSRP3. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]'