IRF6 (NM_006147) Human Mass Spec Standard

CAT#: PH301579

IRF6 MS Standard C13 and N15-labeled recombinant protein (NP_006138)

Product Images

Coomassie blue staining of purified IRF6 protein (Cat# TP301579). The protein was produced from HEK293T cells transfected with IRF6 cDNA clone (Cat# RC201579) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201579
• Predicted MW: 53.1 kDa
• Protein Sequence:
  Sequence Link

  >RC201579 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALHPRRVRLKPWLVAQVDSGLYPGLIWLHRDSKRFQIPWKHATRHSPQQEEENTIFKAWAVETGKYQEG
  VDDPDPAKWKAQLRCALNKSREFNLMYDGTKEVPMNPVKIYQVCDIPQPQGSIINPGSTGSAPWDEKDND
  VDEEDEEDELDQSQHHVPIQDTFPFLNINGSPMAPASVGNCSVGNCSPEAVWPKTEPLEMEVPQAPIQPF
  YSSPELWISSLPMTDLDIKFQYRGKEYGQTMTVSNPQGCRLFYGDLGPMPDQEELFGPVSLEQVKFPGPE
  HITNEKQKLFTSKLLDVMDRGLILEVSGHAIYAIRLCQCKVYWSGPCAPSLVAPNLIERQKKVKLFCLET
  FLSDLIAHQKGQIEKQPPFEIYLCFGEEWPDGKPLERKLILVQVIPVVARMIYEMFSGDFTRSFDSGSVR
  LQISTPDIKDNIVAQLKQLYRILQTQESWQPMQPTPSMQLPPALPPQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006138
• RefSeq Size: 4505
• RefSeq ORF: 1401
• Synonyms: LPS; OFC6; PIT; PPS; PPS1; VWS; VWS1
• Locus ID: 3664
• UniProt ID: O14896, G0Z349
• Cytogenetics: 1q32.2
• Summary: 'This gene encodes a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. The encoded protein may be a transcriptional activator. Mutations in this gene can cause van der Woude syndrome and popliteal pterygium syndrome. Mutations in this gene are also associated with non-syndromic orofacial cleft type 6. Alternate splicing results in multiple transcript variants.[provided by RefSeq, May 2011]'
• Protein Families: ES Cell Differentiation/IPS, Transcription Factors