MNAT1 (NM_002431) Human Mass Spec Standard

CAT#: PH301595

MNAT1 MS Standard C13 and N15-labeled recombinant protein (NP_002422)

Product Images

Coomassie blue staining of purified MNAT1 protein (Cat# TP301595). The protein was produced from HEK293T cells transfected with MNAT1 cDNA clone (Cat# RC201595) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201595
• Predicted MW: 35.8 kDa
• Protein Sequence:
  Sequence Link

  >RC201595 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGTPLRKSNFRVQLFEDPTVDK
  EVEIRKKVLKIYNKREEDFPSLREYNDFLEEVEEIVFNLTNNVDLDNTKKKMEIYQKENKDVIQKNKLKL
  TREQEELEEALEVERQENEQRRLFIQKEEQLQQILKRKNKQAFLDELESSDLPVALLLAQHKDRSTQLEM
  QLEKPKPVKPVTFSTGIKMGQHISLAPIHKLEEALYEYQPLQIETYGPHVPELEMLGRLGYLNHVRAASP
  QDLAGGYTSSLACHRALQDAFSGLFWQPS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002422
• RefSeq Size: 1397
• RefSeq ORF: 927
• Synonyms: CAP35; MAT1; RNF66; TFB3
• Locus ID: 4331
• UniProt ID: P51948, A0A024R688
• Cytogenetics: 14q23.1
• Summary: 'The protein encoded by this gene, along with cyclin H and CDK7, forms the CDK-activating kinase (CAK) enzymatic complex. This complex activates several cyclin-associated kinases and can also associate with TFIIH to activate transcription by RNA polymerase II. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]'
• Protein Families: Druggable Genome, Stem cell - Pluripotency, Transcription Factors
• Protein Pathways: Nucleotide excision repair