Proteasome 20S beta 6 (PSMB6) (NM_002798) Human Mass Spec Standard

CAT#: PH301605

PSMB6 MS Standard C13 and N15-labeled recombinant protein (NP_002789)

Product Images

Coomassie blue staining of purified PSMB6 protein (Cat# TP301605). The protein was produced from HEK293T cells transfected with PSMB6 cDNA clone (Cat# RC201605) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201605
• Predicted MW: 25.4 kDa
• Protein Sequence:
  Sequence Link

  >RC201605 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAATLLAARGAGPAPAWGPEAFTPDWESREVSTGTTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTP
  IHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQ
  EGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKEECLQFTANALALAMERDGSSGGVIRL
  AAIAESGVERQVLLGDQIPKFAVATLPPA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002789
• RefSeq Size: 869
• RefSeq ORF: 717
• Synonyms: DELTA; LMPY; Y
• Locus ID: 5694
• UniProt ID: P28072, Q6IAT9
• Cytogenetics: 17p13.2
• Summary: 'The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. The encoded protein is a member of the proteasome B-type family, also known as the T1B family, and is a 20S core beta subunit in the proteasome. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]'
• Protein Families: Druggable Genome, Protease
• Protein Pathways: Proteasome