NCOA4 (NM_005437) Human Mass Spec Standard
CAT#: PH301606
NCOA4 MS Standard C13 and N15-labeled recombinant protein (NP_005428)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201606 |
Predicted MW | 69.7 kDa |
Protein Sequence |
>RC201606 protein sequence
Red=Cloning site Green=Tags(s) MNTFQDQSGSSSNREPLLRCSDARRDLELAIGGVLRAEQQIKDNLREVKAQIHSCISRHLECLRSREVWL YEQVDLIYQLKEETLQQQAQQLYSLLGQFNCLTHQLECTQNKDLANQVSVCLERLGSLTLKPEDSTVLLF EADTITLRQTITTFGSLKTIQIPEHLMAHASSANIGPFLEKRGCISMPEQKSASGIVAVPFSEWLLGSKP ASGYQAPYIPSTDPQDWLTQKQTLENSQTSSRACNFFNNVGGNLKGLENWLLKSEKSSYQKCNSHSTTSS FSIEMEKVGDQELPDQDEMDLSDWLVTPQESHKLRKPENGSRETSEKFKLLFQSYNVNDWLVKTDSCTNC QGNQPKGVEIENLGNLKCLNDHLEAKKPLSTPSMVTEDWLVQNHQDPCKVEEVCRANEPCTSFAECVCDE NCEKEALYKWLLKKEGKDKNGMPVEPKPEPEKHKDSLNMWLCPRKEVIEQTKAPKAMTPSRIADSFQVIK NSPLSEWLIRPPYKEGSPKEVPGTEDRAGKQKFKSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWL LRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQM myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005428 |
RefSeq Size | 3502 |
RefSeq ORF | 1842 |
Synonyms | ARA70; ELE1; PTC3; RFG |
Locus ID | 8031 |
UniProt ID | Q13772, A0A024QZI5, Q96E88 |
Cytogenetics | 10q11.22 |
Summary | This gene encodes an androgen receptor coactivator. The encoded protein interacts with the androgen receptor in a ligand-dependent manner to enhance its transcriptional activity. Chromosomal translocations between this gene and the ret tyrosine kinase gene, also located on chromosome 10, have been associated with papillary thyroid carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes are present on chromosomes 4, 5, 10, and 14. [provided by RefSeq, Feb 2009] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Pathways in cancer, Thyroid cancer |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401665 | NCOA4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428770 | NCOA4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428771 | NCOA4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401665 | Transient overexpression lysate of nuclear receptor coactivator 4 (NCOA4), transcript variant 5 |
USD 396.00 |
|
LY428770 | Transient overexpression lysate of nuclear receptor coactivator 4 (NCOA4), transcript variant 3 |
USD 396.00 |
|
LY428771 | Transient overexpression lysate of nuclear receptor coactivator 4 (NCOA4), transcript variant 4 |
USD 396.00 |
|
PH326691 | NCOA4 MS Standard C13 and N15-labeled recombinant protein (NP_001138734) |
USD 2,055.00 |
|
TP301606 | Recombinant protein of human nuclear receptor coactivator 4 (NCOA4), transcript variant 5 |
USD 823.00 |
|
TP326691 | Purified recombinant protein of Homo sapiens nuclear receptor coactivator 4 (NCOA4), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review