NCOA4 (NM_005437) Human Recombinant Protein
CAT#: TP301606
Recombinant protein of human nuclear receptor coactivator 4 (NCOA4), transcript variant 5
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201606 protein sequence
Red=Cloning site Green=Tags(s) MNTFQDQSGSSSNREPLLRCSDARRDLELAIGGVLRAEQQIKDNLREVKAQIHSCISRHLECLRSREVWL YEQVDLIYQLKEETLQQQAQQLYSLLGQFNCLTHQLECTQNKDLANQVSVCLERLGSLTLKPEDSTVLLF EADTITLRQTITTFGSLKTIQIPEHLMAHASSANIGPFLEKRGCISMPEQKSASGIVAVPFSEWLLGSKP ASGYQAPYIPSTDPQDWLTQKQTLENSQTSSRACNFFNNVGGNLKGLENWLLKSEKSSYQKCNSHSTTSS FSIEMEKVGDQELPDQDEMDLSDWLVTPQESHKLRKPENGSRETSEKFKLLFQSYNVNDWLVKTDSCTNC QGNQPKGVEIENLGNLKCLNDHLEAKKPLSTPSMVTEDWLVQNHQDPCKVEEVCRANEPCTSFAECVCDE NCEKEALYKWLLKKEGKDKNGMPVEPKPEPEKHKDSLNMWLCPRKEVIEQTKAPKAMTPSRIADSFQVIK NSPLSEWLIRPPYKEGSPKEVPGTEDRAGKQKFKSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWL LRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 69.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005428 |
Locus ID | 8031 |
UniProt ID | Q13772, A0A024QZI5, Q96E88 |
Cytogenetics | 10q11.22 |
Refseq Size | 3502 |
Refseq ORF | 1842 |
Synonyms | ARA70; ELE1; PTC3; RFG |
Summary | This gene encodes an androgen receptor coactivator. The encoded protein interacts with the androgen receptor in a ligand-dependent manner to enhance its transcriptional activity. Chromosomal translocations between this gene and the ret tyrosine kinase gene, also located on chromosome 10, have been associated with papillary thyroid carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes are present on chromosomes 4, 5, 10, and 14. [provided by RefSeq, Feb 2009] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Pathways in cancer, Thyroid cancer |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401665 | NCOA4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC428770 | NCOA4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC428771 | NCOA4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY401665 | Transient overexpression lysate of nuclear receptor coactivator 4 (NCOA4), transcript variant 5 |
USD 325.00 |
|
LY428770 | Transient overexpression lysate of nuclear receptor coactivator 4 (NCOA4), transcript variant 3 |
USD 325.00 |
|
LY428771 | Transient overexpression lysate of nuclear receptor coactivator 4 (NCOA4), transcript variant 4 |
USD 325.00 |
|
PH301606 | NCOA4 MS Standard C13 and N15-labeled recombinant protein (NP_005428) |
USD 2,055.00 |
|
PH326691 | NCOA4 MS Standard C13 and N15-labeled recombinant protein (NP_001138734) |
USD 2,055.00 |
|
TP326691 | Purified recombinant protein of Homo sapiens nuclear receptor coactivator 4 (NCOA4), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review