IFITM1 (NM_003641) Human Mass Spec Standard
CAT#: PH301617
IFITM1 MS Standard C13 and N15-labeled recombinant protein (NP_003632)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201617 |
Predicted MW | 13.9 kDa |
Protein Sequence |
>RC201617 protein sequence
Red=Cloning site Green=Tags(s) MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVG DVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003632 |
RefSeq Size | 733 |
RefSeq ORF | 375 |
Synonyms | 9-27; CD225; DSPA2a; IFI17; LEU13 |
Locus ID | 8519 |
UniProt ID | P13164, A0A024R210 |
Cytogenetics | 11p15.5 |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | B cell receptor signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401205 | IFITM1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY401205 | Transient overexpression lysate of interferon induced transmembrane protein 1 (9-27) (IFITM1) |
USD 325.00 |
|
TP301617 | Recombinant protein of human interferon induced transmembrane protein 1 (9-27) (IFITM1) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review