IFITM1 (NM_003641) Human Mass Spec Standard

CAT#: PH301617

IFITM1 MS Standard C13 and N15-labeled recombinant protein (NP_003632)

Product Images

Coomassie blue staining of purified IFITM1 protein (Cat# TP301617). The protein was produced from HEK293T cells transfected with IFITM1 cDNA clone (Cat# RC201617) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201617
• Predicted MW: 13.9 kDa
• Protein Sequence:
  Sequence Link

  >RC201617 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVG
  DVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003632
• RefSeq Size: 733
• RefSeq ORF: 375
• Synonyms: 9-27; CD225; DSPA2a; IFI17; LEU13
• Locus ID: 8519
• UniProt ID: P13164, A0A024R210
• Cytogenetics: 11p15.5
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: B cell receptor signaling pathway