Beclin 1 (BECN1) (NM_003766) Human Mass Spec Standard

CAT#: PH301629

BECN1 MS Standard C13 and N15-labeled recombinant protein (NP_003757)

Product Images

Coomassie blue staining of purified BECN1 protein (Cat# TP301629). The protein was produced from HEK293T cells transfected with BECN1 cDNA clone (Cat# RC201629) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201629
• Predicted MW: 51.7 kDa
• Protein Sequence:
  Sequence Link

  >RC201629 representing NM_003766
  Red=Cloning site Green=Tags(s)
  
  MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFI
  ETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEEC
  TDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAE
  NLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSG
  QFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELP
  LYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFN
  SEEQWTKALKFMLTNLKWGLAWVSSQFYNK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003757
• RefSeq Size: 2144
• RefSeq ORF: 1350
• Synonyms: ATG6; beclin1; VPS30
• Locus ID: 8678
• UniProt ID: Q14457, A0A024R1X5
• Cytogenetics: 17q21.31
• Summary: This gene encodes a protein that regulates autophagy, a catabolic process of degradation induced by starvation. The encoded protein is a component of the phosphatidylinositol-3-kinase (PI3K) complex which mediates vesicle-trafficking processes. This protein is thought to play a role in multiple cellular processes, including tumorigenesis, neurodegeneration and apoptosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015]
• Protein Families: Druggable Genome
• Protein Pathways: Regulation of autophagy