EBP50 (SLC9A3R1) (NM_004252) Human Mass Spec Standard

CAT#: PH301653

SLC9A3R1 MS Standard C13 and N15-labeled recombinant protein (NP_004243)

Product Images

Coomassie blue staining of purified SLC9A3R1 protein (Cat# TP301653). The protein was produced from HEK293T cells transfected with SLC9A3R1 cDNA clone (Cat# RC201653) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201653
• Predicted MW: 38.9 kDa
• Protein Sequence:
  Sequence Link

  >RC201653 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSADAAAGAPLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKE
  THQQVVSRIRAALNAVRLLVVDPETDEQLQKLGVQVREELLRAQEAPGQAEPPAAAEVQGAGNENEPREA
  DKSHPEQRELRPRLCTMKKGPSGYGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGK
  QHGDVVSAIRAGGDETKLLVVDRETDEFFKKCRVIPSQEHLNGPLPVPFTNGEIQKENSREALAEAALES
  PRPALVRSASSDTSEELNSQDSPPKQDSTAPSSTSSSDPILDFNISLAMAKERAHQKRSSKRAPQMDWSK
  KNELFSNL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004243
• RefSeq Size: 2032
• RefSeq ORF: 1074
• Synonyms: EBP50; NHERF; NHERF-1; NHERF1; NPHLOP2
• Locus ID: 9368
• UniProt ID: O14745
• Cytogenetics: 17q25.1
• Summary: This gene encodes a sodium/hydrogen exchanger regulatory cofactor. The protein interacts with and regulates various proteins including the cystic fibrosis transmembrane conductance regulator and G-protein coupled receptors such as the beta2-adrenergic receptor and the parathyroid hormone 1 receptor. The protein also interacts with proteins that function as linkers between integral membrane and cytoskeletal proteins. The protein localizes to actin-rich structures including membrane ruffles, microvilli, and filopodia. Mutations in this gene result in hypophosphatemic nephrolithiasis/osteoporosis type 2, and loss of heterozygosity of this gene is implicated in breast cancer. [provided by RefSeq, Sep 2009]
• Protein Families: Druggable Genome