CREG1 (NM_003851) Human Mass Spec Standard

CAT#: PH301654

CREG1 MS Standard C13 and N15-labeled recombinant protein (NP_003842)

Product Images

Coomassie blue staining of purified CREG1 protein (Cat# TP301654). The protein was produced from HEK293T cells transfected with CREG1 cDNA clone (Cat# RC201654) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201654
• Predicted MW: 24.1 kDa
• Protein Sequence:
  Sequence Link

  >RC201654 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGLSRGSARALLAALLASTLLALLVSPARGRGGRDHGDWDEASRLPPLPPREDAARVARFVTHVSDWGA
  LATISTLEAVRGRPFADVLSLSDGPPGAGSGVPYFYLSPLQLSVSNLQENPYATLTMTLAQTNFCKKHGF
  DPQSPLCVHIMLSGTVTKVNETEMDIAKHSLFIRHPEMKTWPSSHNWFFAKLNITNIWVLDYFGGPKIVT
  PEEYYNVTVQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003842
• RefSeq Size: 2048
• RefSeq ORF: 660
• Synonyms: CREG
• Locus ID: 8804
• UniProt ID: O75629
• Cytogenetics: 1q24.2
• Summary: The adenovirus E1A protein both activates and represses gene expression to promote cellular proliferation and inhibit differentiation. The protein encoded by this gene antagonizes transcriptional activation and cellular transformation by E1A. This protein shares limited sequence similarity with E1A and binds both the general transcription factor TBP and the tumor suppressor pRb in vitro. This gene may contribute to the transcriptional control of cell growth and differentiation. [provided by RefSeq, Jul 2008]
• Protein Families: Secreted Protein, Transcription Factors, Transmembrane