TCTP (TPT1) (NM_003295) Human Mass Spec Standard

CAT#: PH301664

TPT1 MS Standard C13 and N15-labeled recombinant protein (NP_003286)

Product Images

Coomassie blue staining of purified TPT1 protein (Cat# TP301664). The protein was produced from HEK293T cells transfected with TPT1 cDNA clone (Cat# RC201664) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201664
• Predicted MW: 19.6 kDa
• Protein Sequence:
  Sequence Link

  >RC201664 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGV
  DIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENM
  NPDGMVALLDYREDGVTPYMIFFKDGLEMEKC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003286
• RefSeq Size: 4649
• RefSeq ORF: 516
• Synonyms: HRF; p02; p23; TCTP
• Locus ID: 7178
• UniProt ID: P13693, A0A0P1J1R0
• Cytogenetics: 13q14.13
• Summary: 'This gene encodes a protein that is a regulator of cellular growth and proliferation. Its mRNA is highly structured and contains an oligopyrimidine tract (5'-TOP) in its 5' untranslated region that functions to repress its translation under quiescent conditions. The encoded protein is involved in a variety of cellular pathways, including apoptosis, protein synthesis and cell division. It binds to and stabilizes microtubules, and removal of this protein through phosphorylation is required for progression through mitotic and meiotic cell divisions. This gene is known to play a role in carcinogenesis, and is upregulated in some cancer cells. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Aug 2017]'