RHOD (NM_014578) Human Mass Spec Standard
CAT#: PH301722
RHOD MS Standard C13 and N15-labeled recombinant protein (NP_055393)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201722 |
| Predicted MW | 23.5 kDa |
| Protein Sequence |
>RC201722 protein sequence
Red=Cloning site Green=Tags(s) MTAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVFERYMVNLQVKGKPVHLHIW DTAGQDDYDRLRPLFYPDASVLLLCFDVTSPNSFDNIFNRWYPEVNHFCKKVPIIVVGCKTDLRKDKSLV NKLRRNGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSSRGRNFWRRITQGFCVVT myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_055393 |
| RefSeq Size | 1150 |
| RefSeq ORF | 630 |
| Synonyms | ARHD; Rho; RHOHP1; RHOM |
| Locus ID | 29984 |
| UniProt ID | O00212 |
| Cytogenetics | 11q13.2 |
| Summary | Ras homolog, or Rho, proteins interact with protein kinases and may serve as targets for activated GTPase. They play a critical role in muscle differentiation. The protein encoded by this gene binds GTP and is a member of the small GTPase superfamily. It is involved in endosome dynamics and reorganization of the actin cytoskeleton, and it may coordinate membrane transport with the function of the cytoskeleton. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014] |
| Protein Pathways | Axon guidance |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415197 | RHOD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY415197 | Transient overexpression lysate of ras homolog gene family, member D (RHOD) |
USD 436.00 |
|
| TP301722 | Recombinant protein of human ras homolog gene family, member D (RHOD) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China