NTF2 (NUTF2) (NM_005796) Human Mass Spec Standard

CAT#: PH301728

NUTF2 MS Standard C13 and N15-labeled recombinant protein (NP_005787)

Product Images

Coomassie blue staining of purified NUTF2 protein (Cat# TP301728). The protein was produced from HEK293T cells transfected with NUTF2 cDNA clone (Cat# RC201728) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201728
• Predicted MW: 14.5 kDa
• Protein Sequence:
  Sequence Link

  >RC201728 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITA
  QDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005787
• RefSeq Size: 894
• RefSeq ORF: 381
• Synonyms: NTF-2; NTF2; PP15
• Locus ID: 10204
• UniProt ID: P61970, A0A024R6Y2
• Cytogenetics: 16q22.1
• Summary: This gene encodes a cytosolic factor that facilitates protein transport into the nucleus. The encoded protein is required for nuclear import of the small Ras-like GTPase, Ran which is involved in numerous cellular processes. This protein also interacts with the nuclear pore complex glycoprotein p62. [provided by RefSeq, Apr 2016]