NM23A (NME1) (NM_000269) Human Mass Spec Standard
CAT#: PH301731
NME1 MS Standard C13 and N15-labeled recombinant protein (NP_000260)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201731 |
Predicted MW | 17.1 kDa |
Protein Sequence |
>RC201731 protein sequence
Red=Cloning site Green=Tags(s) MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHS GPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELV DYTSCAQNWIYE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000260 |
RefSeq Size | 811 |
RefSeq ORF | 456 |
Synonyms | AWD; GAAD; NB; NBS; NDKA; NDPK-A; NDPKA; NM23; NM23-H1 |
Locus ID | 4830 |
UniProt ID | P15531, A0A384MTW7 |
Cytogenetics | 17q21.33 |
Summary | 'This gene (NME1) was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by this gene) and 'B' (encoded by NME2) isoforms. Mutations in this gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways | Metabolic pathways, Purine metabolism, Pyrimidine metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400102 | NME1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC404982 | NME1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400102 | Transient overexpression lysate of non-metastatic cells 1, protein (NM23A) expressed in (NME1), transcript variant 2 |
USD 396.00 |
|
LY404982 | Transient overexpression lysate of non-metastatic cells 1, protein (NM23A) expressed in (NME1), transcript variant 1 |
USD 396.00 |
|
PH320517 | NME1 MS Standard C13 and N15-labeled recombinant protein (NP_937818) |
USD 2,055.00 |
|
TP301731 | Recombinant protein of human non-metastatic cells 1, protein (NM23A) expressed in (NME1), transcript variant 2 |
USD 823.00 |
|
TP320517 | Recombinant protein of human non-metastatic cells 1, protein (NM23A) expressed in (NME1), transcript variant 1 |
USD 748.00 |
|
TP720214 | Recombinant protein of human non-metastatic cells 1, protein (NM23A) expressed in (NME1), transcript variant 2 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review