CD63 (NM_001780) Human Mass Spec Standard

CAT#: PH301733

CD63 MS Standard C13 and N15-labeled recombinant protein (NP_001771)

Product Images

Coomassie blue staining of purified CD63 protein (Cat# TP301733). The protein was produced from HEK293T cells transfected with CD63 cDNA clone (Cat# RC201733) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201733
• Predicted MW: 25.6 kDa
• Protein Sequence:
  Sequence Link

  >RC201733 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFV
  GCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQ
  ADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAA
  LGIAFVEVLGIVFACCLVKSIRSGYEVM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001771
• RefSeq Size: 1032
• RefSeq ORF: 714
• Synonyms: LAMP-3; ME491; MLA1; OMA81H; TSPAN30
• Locus ID: 967
• UniProt ID: P08962, A0A024RB05
• Cytogenetics: 12q13.2
• Summary: 'The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The encoded protein is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak syndrome. Also this gene has been associated with tumor progression. Alternative splicing results in multiple transcript variants encoding different protein isoforms. [provided by RefSeq, Apr 2012]'
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Lysosome