ERAB (HSD17B10) (NM_004493) Human Mass Spec Standard
CAT#: PH301734
HSD17B10 MS Standard C13 and N15-labeled recombinant protein (NP_004484)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201734 |
Predicted MW | 26.9 kDa |
Protein Sequence |
>RC201734 protein sequence
Red=Cloning site Green=Tags(s) MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKD VQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNE PDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLP EKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_004484 |
RefSeq Size | 963 |
RefSeq ORF | 783 |
Synonyms | 17b-HSD10; ABAD; CAMR; DUPXp11.22; ERAB; HADH2; HCD2; HSD10MD; MHBD; MRPP2; MRX17; MRX31; MRXS10; SCHAD; SDR5C1 |
Locus ID | 3028 |
UniProt ID | Q99714, A0A0S2Z410 |
Cytogenetics | Xp11.22 |
Summary | 'This gene encodes 3-hydroxyacyl-CoA dehydrogenase type II, a member of the short-chain dehydrogenase/reductase superfamily. The gene product is a mitochondrial protein that catalyzes the oxidation of a wide variety of fatty acids and steroids, and is a subunit of mitochondrial ribonuclease P, which is involved in tRNA maturation. The protein has been implicated in the development of Alzheimer disease, and mutations in the gene are the cause of 17beta-hydroxysteroid dehydrogenase type 10 (HSD10) deficiency. Several alternatively spliced transcript variants have been identified, but the full-length nature of only two transcript variants has been determined. [provided by RefSeq, Aug 2014]' |
Protein Families | Druggable Genome |
Protein Pathways | Alzheimer's disease, Metabolic pathways, Valine, leucine and isoleucine degradation |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401426 | HSD17B10 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC421990 | HSD17B10 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY401426 | Transient overexpression lysate of hydroxysteroid (17-beta) dehydrogenase 10 (HSD17B10), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 325.00 |
|
LY421990 | Transient overexpression lysate of hydroxysteroid (17-beta) dehydrogenase 10 (HSD17B10), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 325.00 |
|
TP301734 | Recombinant protein of human hydroxysteroid (17-beta) dehydrogenase 10 (HSD17B10), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review