PCNA (NM_002592) Human Mass Spec Standard

CAT#: PH301741

PCNA MS Standard C13 and N15-labeled recombinant protein (NP_002583)

Product Images

Coomassie blue staining of purified PCNA protein (Cat# TP301741). The protein was produced from HEK293T cells transfected with PCNA cDNA clone (Cat# RC201741) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201741
• Predicted MW: 28.8 kDa
• Protein Sequence:
  Sequence Link

  >RC201741 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGV
  NLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMP
  SGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALR
  YLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002583
• RefSeq Size: 1355
• RefSeq ORF: 783
• Synonyms: ATLD2
• Locus ID: 5111
• UniProt ID: P12004
• Cytogenetics: 20p12.3
• Summary: 'The protein encoded by this gene is found in the nucleus and is a cofactor of DNA polymerase delta. The encoded protein acts as a homotrimer and helps increase the processivity of leading strand synthesis during DNA replication. In response to DNA damage, this protein is ubiquitinated and is involved in the RAD6-dependent DNA repair pathway. Two transcript variants encoding the same protein have been found for this gene. Pseudogenes of this gene have been described on chromosome 4 and on the X chromosome. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Stem cell - Pluripotency
• Protein Pathways: Base excision repair, Cell cycle, DNA replication, Mismatch repair, Nucleotide excision repair