COX7C (NM_001867) Human Mass Spec Standard

CAT#: PH301768

COX7C MS Standard C13 and N15-labeled recombinant protein (NP_001858)

Product Images

Coomassie blue staining of purified COX7C protein (Cat# TP301768). The protein was produced from HEK293T cells transfected with COX7C cDNA clone (Cat# RC201768) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201768
• Predicted MW: 7.2 kDa
• Protein Sequence:
  Sequence Link

  >RC201768 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLKT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001858
• RefSeq Size: 448
• RefSeq ORF: 189
• Synonyms: cytochrome-c oxidase chain VIIc; cytochrome c oxidase subunit VIIc
• Locus ID: 1350
• UniProt ID: P15954
• Cytogenetics: 5q14.3
• Summary: 'Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes subunit VIIc, which shares 87% and 85% amino acid sequence identity with mouse and bovine COX VIIc, respectively, and is found in all tissues. A pseudogene COX7CP1 has been found on chromosome 13. [provided by RefSeq, Jul 2008]'
• Protein Pathways: Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease