RAB7 (RAB7A) (NM_004637) Human Mass Spec Standard

CAT#: PH301776

RAB7A MS Standard C13 and N15-labeled recombinant protein (NP_004628)

Product Images

Coomassie blue staining of purified RAB7A protein (Cat# TP301776). The protein was produced from HEK293T cells transfected with RAB7A cDNA clone (Cat# RC201776) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201776
• Predicted MW: 23.5 kDa
• Protein Sequence:
  Sequence Link

  >RC201776 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERF
  QSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQVATKRAQ
  AWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEVELYNEFPEPIKLDKNDRAKASAESCSC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004628
• RefSeq Size: 2240
• RefSeq ORF: 621
• Synonyms: PRO2706; RAB7
• Locus ID: 7879
• UniProt ID: P51149, A0A158RFU6
• Cytogenetics: 3q21.3
• Summary: RAB family members are small, RAS-related GTP-binding proteins that are important regulators of vesicular transport. Each RAB protein targets multiple proteins that act in exocytic / endocytic pathways. This gene encodes a RAB family member that regulates vesicle traffic in the late endosomes and also from late endosomes to lysosomes. This encoded protein is also involved in the cellular vacuolation of the VacA cytotoxin of Helicobacter pylori. Mutations at highly conserved amino acid residues in this gene have caused some forms of Charcot-Marie-Tooth (CMT) type 2 neuropathies. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome