PLK1 (NM_005030) Human Mass Spec Standard

CAT#: PH301795

PLK1 MS Standard C13 and N15-labeled recombinant protein (NP_005021)

Product Images

Coomassie blue staining of purified PLK1 protein (Cat# TP301795). The protein was produced from HEK293T cells transfected with PLK1 cDNA clone (Cat# RC201795) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201795
• Predicted MW: 68.1 kDa
• Protein Sequence:
  Sequence Link

  >RC201795 representing NM_005030
  Red=Cloning site Green=Tags(s)
  
  MSAAVTAGKLARAPADPGKAGVPGVAAPGAPAAAPPAKEIPEVLVDPRSRRRYVRGRFLGKGGFAKCFEI
  SDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLE
  LHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKT
  LCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAAS
  LIQKMLQTDPTARPTINELLNDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGLENP
  LPERPREKEEPVVRETGEVVDCHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDK
  YGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHL
  LKAGANITPREGDELARLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFR
  TYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRLKAS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005021
• RefSeq Size: 2204
• RefSeq ORF: 1809
• Synonyms: PLK; STPK13
• Locus ID: 5347
• UniProt ID: P53350
• Cytogenetics: 16p12.2
• Summary: 'The Ser/Thr protein kinase encoded by this gene belongs to the CDC5/Polo subfamily. It is highly expressed during mitosis and elevated levels are found in many different types of cancer. Depletion of this protein in cancer cells dramatically inhibited cell proliferation and induced apoptosis; hence, it is a target for cancer therapy. [provided by RefSeq, Sep 2015]'
• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation