Synaptogyrin 2 (SYNGR2) (NM_004710) Human Mass Spec Standard

CAT#: PH301819

SYNGR2 MS Standard C13 and N15-labeled recombinant protein (NP_004701)

Product Images

Coomassie blue staining of purified SYNGR2 protein (Cat# TP301819). The protein was produced from HEK293T cells transfected with SYNGR2 cDNA clone (Cat# RC201819) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201819
• Predicted MW: 24.8 kDa
• Protein Sequence:
  Sequence Link

  >RC201819 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MESGAYGAAKAGGSFDLRRFLTQPQVVARAVCLVFALIVFSCIYGEGYSNAHESKQMYCVFNRNEDACRY
  GSAIGVLAFLASAFFLVVDAYFPQISNATDRKYLVIGDLLFSALWTFLWFVGFCFLTNQWAVTNPKDVLV
  GADSVRAAITFSFFSIFSWGVLASLAYQRYKAGVDDFIQNYVDPTPDPNTAYASYPGASVDNYQQPPFTQ
  NAETTEGYQPPPVY
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004701
• RefSeq Size: 1694
• RefSeq ORF: 672
• Synonyms: MGC102914
• Locus ID: 9144
• UniProt ID: O43760, A0A024R8T9
• Cytogenetics: 17q25.3
• Summary: This gene encodes an integral membrane protein containing four transmembrane regions and a C-terminal cytoplasmic tail that is tyrosine phosphorylated. The exact function of this protein is unclear, but studies of a similar rat protein suggest that it may play a role in regulating membrane traffic in non-neuronal cells. The gene belongs to the synaptogyrin gene family. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]
• Protein Families: Transmembrane