UBE2V1 (NM_001032288) Human Mass Spec Standard

CAT#: PH301824

UBE2V1 MS Standard C13 and N15-labeled recombinant protein (NP_001027459)

Product Images

Coomassie blue staining of purified UBE2V1 protein (Cat# TP301824). The protein was produced from HEK293T cells transfected with UBE2V1 cDNA clone (Cat# RC201824) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201824
• Predicted MW: 16.5 kDa
• Protein Sequence:
  Sequence Link

  >RC201824 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIE
  CGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPP
  EGQCYSN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001027459
• RefSeq Size: 2158
• RefSeq ORF: 441
• Synonyms: CIR1; CROC-1; CROC1; UBE2V; UEV-1; UEV1; UEV1A
• Locus ID: 7335
• UniProt ID: Q13404
• Cytogenetics: 20q13.13
• Summary: 'Ubiquitin-conjugating E2 enzyme variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein encoded by this gene is located in the nucleus and can cause transcriptional activation of the human FOS proto-oncogene. It is thought to be involved in the control of differentiation by altering cell cycle behavior. Alternatively spliced transcript variants encoding multiple isoforms have been described for this gene, and multiple pseudogenes of this gene have been identified. Co-transcription of this gene and the neighboring upstream gene generates a rare transcript (Kua-UEV), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq, Apr 2012]'
• Protein Families: Druggable Genome, Transcription Factors