EIF3S2 (EIF3I) (NM_003757) Human Mass Spec Standard

CAT#: PH301833

EIF3I MS Standard C13 and N15-labeled recombinant protein (NP_003748)

Product Images

Coomassie blue staining of purified EIF3I protein (Cat# TP301833). The protein was produced from HEK293T cells transfected with EIF3I cDNA clone (Cat# RC201833) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201833
• Predicted MW: 36.5 kDa
• Protein Sequence:
  Sequence Link

  >RC201833 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDADWDTKHVLTG
  SADNSCRLWDCETGKQLALLKTNSAVRTCGFDFGGNIIMFSTDKQMGYQCFVSFFDLRDPSQIDNNEPYM
  KIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEVLVNVKEHSRQINDIQLSRDMTMFVTASKDN
  TAKLFDSTTLEHQKTFRTERPVNSAALSPNYDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGR
  VKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEFEA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003748
• RefSeq Size: 1458
• RefSeq ORF: 975
• Synonyms: eIF3-beta; eIF3-p36; EIF3S2; PRO2242; TRIP-1; TRIP1
• Locus ID: 8668
• UniProt ID: Q13347, Q5U0F4
• Cytogenetics: 1p35.2